PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family S1Fa-like
Protein Properties Length: 77aa    MW: 8191.85 Da    PI: 10.933
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18904genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA133.93.9e-421176570
                       S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                               ++ ++G+nPGlivllvvgglll+fl+gny+lyvyaqk++PPrkkkP+skkk+k+e+lkqGv++PGe
  Tp57577_TGAC_v2_mRNA18904 11 NAGSQGFNPGLIVLLVVGGLLLTFLIGNYVLYVYAQKTIPPRKKKPISKKKMKKERLKQGVSAPGE 76
                               56789************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046892.5E-401376IPR006779DNA binding protein S1FA
ProDomPD0190131.0E-41476No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MAADKVPPNA NAGSQGFNPG LIVLLVVGGL LLTFLIGNYV LYVYAQKTIP PRKKKPISKK  60
KMKKERLKQG VSAPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1344944e-73BT134494.1 Medicago truncatula clone JCVI-FLMt-1F14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.16e-27DNA-binding protein S1FA1
SwissprotQ423372e-16S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLW9SCA36e-27W9SCA3_9R
STRINGPGSC0003DMT4000044415e-19(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.19e-06S1FA-like DNA-binding protein